SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685693|ref|YP_001868889.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685693|ref|YP_001868889.1|
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000204
Family Galacturonase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186685693|ref|YP_001868889.1|
Sequence length 233
Comment hypothetical protein Npun_F5644 [Nostoc punctiforme PCC 73102]
Sequence
MQVESAQAATLTVNNLDDSGVGSLRDTINIASSNDVVEFLLGSNPSTITLTSGALAMPAA
GYAYVNNLTINGPGSNLLTISGNNQFPVFNINAADVTLSGLAIAGDINGYNSSNVTFFNS
TVNDNVKIDNSTGNVTFINSTINGNSVQINANTLTLINDSNVTVPSNPIGGGNSGQSSRG
GNISIGAGTITITSPNVTLRQVPEPSAIAGVILAGGLAWLAKRKQTPLCKAKV
Download sequence
Identical sequences B2J7Y1
gi|186685693|ref|YP_001868889.1| 63737.Npun_F5644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]