SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685697|ref|YP_001868893.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685697|ref|YP_001868893.1|
Domain Number 1 Region: 1073-1243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-35
Family Clostridium neurotoxins, the second last domain 0.068
Further Details:      
 
Weak hits

Sequence:  gi|186685697|ref|YP_001868893.1|
Domain Number - Region: 1707-1804
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.0366
Family Double Clp-N motif 0.017
Further Details:      
 
Domain Number - Region: 1553-1660
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.0942
Family Double Clp-N motif 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685697|ref|YP_001868893.1|
Sequence length 1809
Comment LamG domain-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MSSTITEIISIVKDSIAKTGQFTLKDSTINTLPLGKLMNLLEIPQLDFNLIVSDSENTIT
IAGQSSLLGAGKIAIEATFGEVDGTVSFSVGAKDISSCYIPGISSLVLEQGQFALHVTGK
ADDVTGTFSGSIHVGDTTISNAVFEVTKKDTDIVLHWMIAELDLPAISDVFLNHVSLPAE
LPTFHFKDIAIAISPQTGAFSFEIIAKDLWEFPANGGDLSISEVSLTIERDRRDSLTHCA
ITIQSNVEKEIVNGLKIKDFQLTFDLKGEDWSVDGKVNADVFDDSVTLEASYNQSQAGKT
LKLAAEVDMHPVNLGEISLSLFGLELEFTKPAAQEGEVVPLEWSVAAAGKLSIPGAIESD
GQLTIFREEKARGLQFEAIQAAVSIPLPSTQGMMELNFERLSISGSSSDWTFAAAVDLAF
QGLNPTVQAHLPKDPIAMTFTASKQGVILSIASKSDIESIYFTVPPIELESDRIELGTAK
IGFSSLSIQLGRIVDLEAELNIGLPSQLNNLFGRKKDENGHIENDADGNPLPAVEFFRTL
DLHDEADTTVQVKLVISKAGITLLPETSFIKAIESQTDATGKSFWHCDFGEYGEINVDVP
NFSYTGSSFAASGGFEVVKPLALPLTPIQHLLAACKLPGAAAMLPDRLPLDQEINAENFV
DKLTERLEALLAKLGSGKLSNAAKEVLETISQSFHKLPTSFMEYLNFKMPQSFQFEVAAS
PAGALQFKASVKKDDPPIKLLFPSLMLGMPVLNGVTLRSISFGETAGGQLFLLEMDADID
QFDLATLVAAIALPEDRDPLPSTQAIQRRLRLNNTVMVLPLEFPVPIPMFYDNIGIEYLG
LEGLTLQAHAQFPKPTVELQKISNLLSDIKEFFTNSDHPIPNQLPVEFKFSLNQNYLQLP
KYLGGQALGTQGDGPTLDDKDIVHLLQGIRTLSVNELIQALPLNQRVGSTQVSFGPLSSS
LGWLVTTPDEFSQIITQPTSKAIAYSALGLTTDLQATQILSVLPSASTANEQGIVAFLRG
NFNVGSAKLDTVFGLAASSKGFKTGFEIKGAIAKVVTLNLAGAIAIASPKIAPPTSYALA
FNGQSDYVKLNNPAALNFTGAITISAWIKPDAIDGLQNIVAHGYTSSPSGEVYLRILNGQ
YQFGYWGLNSLPFEQLVAASIPAEDVGNWVYLTGVFDGGMWRLYRNGLLMNAVAGSQGAI
QVSENWAIGARGTGTERFFKGKIADVQIWNRARSLEEIGAAMMRSPKGNEPGLIGYWQLN
EGSGTVAHDATANANHGQLQGTQWQLITANNTAFRLDGSSSLSIPLLNSERPISKGQVQL
IDNQNNHQFHYEGDLQLFSSNSLLKVNGNLKGDINDKTYRFSGDVTTSLAGLTLLGAKAL
IENDLVWLEGTWLGNQTKLTLQTADKAWQIKGIAGFNLPNLSVDLGVVNKVVGSNLIKVA
DNLSINVAANLSLDITLSNNGFSATVSPNCTLNGQKLPLSSFTITVAPSTLEALAEQIKQ
KIKEQASQIFDMLFPNAQAWLDGISSKAIAWTTNAYADMGKVLGSIYGQSASQAVSLLKG
AKYDVDTVGHVLKEGFGKTSDEVTQILHDAQYSAIEVGQTLNRVFGKGANEVTSALKAVG
YKATDVGQMLVSVFNATDNQVASFLKTAGYTASQVGQVLSDVFHESSQATAQILKNVGYT
VSEVGQALADVFQQGSQATAQILKNIGYTASEVGQVLSNVFRQSDQATAQILKNLGYNAS
EVGQVLKNVFGKSANDAASILSNVGYSIIDVARVLKDTFQQGKDSVWNFLKRIGVSIWDI
PKIIKALFG
Download sequence
Identical sequences B2J7Y5
gi|186685697|ref|YP_001868893.1| WP_012411893.1.44837 63737.Npun_F5648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]