SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685814|ref|YP_001869010.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685814|ref|YP_001869010.1|
Domain Number 1 Region: 62-347
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-41
Family Pectate transeliminase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685814|ref|YP_001869010.1|
Sequence length 564
Comment hypothetical protein Npun_R5769 [Nostoc punctiforme PCC 73102]
Sequence
MKYRGFHISIAKNFRLLSSSHLRYTLRGGAGLTAMLAVYCGSILLPGAVNAGATHPQGIA
PTLTAQVPTTAAAIYVNPATGVDSASAGTTSAAPYKSISFALSQAQAGAVIQLAPGNYNQ
ESGETFPLLLKPGVTLRGDEASKGQAILITGGGFYTSRTFARQDITILAEQDTTITGVTV
TNPNSRGTAVWVESTNPTIKNSTFTNSVREGVFVTGTGNPKIESNIFVQNKGNGISIAKA
AQGEIRGNLFQDTGFGLAIGGTSTPLIVENQIVENQDGLFISESAKPVLRKNVIQNNKRD
GVVATVSALPDLGTNENPGGNLIRNNTRYDVNNATKTSKIVAVGNDIDQKKIFGSVDFVA
AAVDVPPGGPVAFKDVPANYWAKTYIEALASQNIIAGFPDGSFKPNEPVTRAQFATIVTK
ALTPPAKRAGIKFKDVATNFWAYAAIQSAYQSQFVSGYPDGTFKPQQQIPRVQALVSLAN
GLGLTANNQNVLSFYTDAAQIPNYAIAPVAAATARQLVINYPTAKQLNPNRQATRAEVAA
FVYQALVSAGRAQPIPSSYLVTAQ
Download sequence
Identical sequences B2J951
NYSGXRC-10360q WP_012412010.1.44837 gi|186685814|ref|YP_001869010.1| 63737.Npun_R5769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]