SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685905|ref|YP_001869101.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685905|ref|YP_001869101.1|
Domain Number 1 Region: 82-548
Classification Level Classification E-value
Superfamily ARM repeat 1.21e-26
Family PBS lyase HEAT-like repeat 0.03
Further Details:      
 
Domain Number 2 Region: 790-928
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000266
Family Extended AAA-ATPase domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685905|ref|YP_001869101.1|
Sequence length 1151
Comment HEAT repeat-containing PBS lyase [Nostoc punctiforme PCC 73102]
Sequence
MYLHIIKKRSSPFFLFPFILLLTLLLALPWVSAKEQPKPKPEAWQINGIVAALDDRHEGV
KSLALDQVSQYEMQDLKTLVKKPEDIARKILSIFKDKSVATSIRVSAGYALSNLGDLAKP
YVKDIAAILKDKSVKVSVRAGAASVLGNLGDAPKPYVKDIVDILKDQSVDFSTGFNLILV
LANLGEPAKPYIKDITDFLKHKNTDSSITIYFSSGNYSASRFSPLANLGDAAKPYLKEIA
NILKDKTADAQVRSRAAFVFAYFGQATQPYIKDILNFIQDKTVDVDVRSTVVDALVNTGK
ATQPYAQDIVNIFKNKSVDSAIRSQIAPTLDNLGDAAKLYVKDIADILKDKSVDNSLRSS
AANALSNLGDAAKPYVKDIADILKDKSVDNSLRSSAANALSNLGDAAKLYVKDIADILKD
KSVDNSLRSSAANALSDLGDAAKPYAKDITDILKDKSVEPSFRSSAAYALSYLEEAAQPY
IKDILDFIQDKTIENQISSQVDKSMAVYALGNLGKVAQPYVKDIVKILKDKSIETSLRSN
LARALEKIEQLDLNSVIVILDNVYYVGQSEFQQWRFSTYFLGGGTEDVTTLLKWLGRPKT
IPEKLNHDEGVKTLEVFRKIWEPSKELVRLQEDLAKQIAVVARKVSWQPQDIVILETHYN
NLKNVGYNEADSLQSVIINLKTWQWLFNARTTILIHAAFWLVLIFAYPKFPQVQAIFFWN
PWVRRILGVGYVGLILTWVPFFREKLFEPFKPSLLADAGLDNFNPEAYFPNSKVKVPGVD
EPVQITQVLPNIKGQVILEGDSGLGKSMFLRYLVKTSGRLVVYLPARKCDKGVIEAIQAK
LHGQAQDADFLKNLIYSGALDICIDGLNEVTADTRAKICQFAESYFRGNIIMTTQPLEWT
PPSTAKIYKLLPLEEPQIQQFLISRQPRLPKNAKVQGTDYEQATASFLTKALSNQQSPQE
LSAIEKVLSNPMDLTVVALMLSQGEYPDLFHLQQHQYQLMAAEYLQEWKQEFPLKKFSDA
VYQMRLNDEQALPADEFYQVLQSLEDDKYKMVVSRQWQDEKGEAKREWYFRHDKIMDFFL
VQSFLGESEEAKNRLLDHMDDPRFRGVYFLLATLLPLDAAKELKEKLVQYAADTKDHTVS
DTFVQLLRPRS
Download sequence
Identical sequences B2JA83
WP_012412101.1.44837 gi|186685905|ref|YP_001869101.1| 63737.Npun_R5860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]