SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686413|ref|YP_001869609.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686413|ref|YP_001869609.1|
Domain Number 1 Region: 598-754
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000676
Family PBS lyase HEAT-like repeat 0.044
Further Details:      
 
Domain Number 2 Region: 51-405
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000615
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 
Domain Number 3 Region: 461-858,930-992
Classification Level Classification E-value
Superfamily ARM repeat 0.00000192
Family PBS lyase HEAT-like repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686413|ref|YP_001869609.1|
Sequence length 1001
Comment hypothetical protein Npun_F6394 [Nostoc punctiforme PCC 73102]
Sequence
MELKNHWFAVNKVVLPRLLQWVNLRPEESERTQLMFIFYTTVCVGLRWAEDSTVALFLDE
YGTHLLPWMYIASAVMSAALVFLYSWLQRIFPLRRVIVAIAPCMLMPLLLLVLLRWGSHV
SYLVVISAFLLRLWVDALYVVNDLNTSIVANQIFNIREIKRTYPLVSSGLLVADVISGFS
LPWLVQYTSLNKIIFIACVVILLGSAILFYLTNHYRAAFPETPQRLIPEEQASRERFIKS
PLKRYVWQLFAFVGLLQVIGLLIDFQYLRELKSNMSDRELASFLGLFGGMLGLCELLLQW
FISSRLIERMGVFFTATLLPITVGFSLPGVLVFLHLIPGIQSQSFFWGLIIVKFCDELLR
YTFVMSSGPILYQPIPESIRSRMQTLSGGTAEAIATGLTGALIFATLLFCNRFVPVSLQK
WVLVAETMLIASTCLKVVWELRSRYVELLVLSVARGQLSASNVGLRFFKQGVVKALGEKG
SEADKRSCIELLAQIDSQGAAEVLAPLLVKLTPDLQRQSLEVMLTAGANPAYLSAIRPLL
EQPQETNPEVFALALRYVWLAEPNPNLSILEEYLNPRQNSLIRATAAALVLRQGTPMQKV
AATQTMRRMLTHKKERERVNGVRALREAVYLQALRIHIPNLLQDESLRVRCAVLEMIAAT
HLEEYYSALIAALYYKSTRTIAMSSLVRLENEAIEMLLRLANNIYKPEVVRMYAWRTIAQ
IGTQEALETLWENLEASWGITRDHILRSLLKIHKQPGIRGLVDRFYESRVENLIEQELKF
LGEIYGAYIDLKILDEKENHQSSQRIVIVSELLQRALLELELDVKERLLLLLRLLYSPEK
MQAAAFNLRSLSVVNLARGLEILEHTVTLPCKSLLLNILDNRPQSEKLQHLVEAKIVEYE
NMLVSDRLHRLLMLGNFLSDWCLACCFHFAQVARIKLTSSEILVSLRHPTGFVREAAIAY
LNMVSHRVLLQILPQLQKDPHPLVAAQVKELLEKYQFKNYN
Download sequence
Identical sequences B2IY67
gi|186686413|ref|YP_001869609.1| 63737.Npun_F6394 WP_012412605.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]