SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686591|ref|YP_001869787.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686591|ref|YP_001869787.1|
Domain Number 1 Region: 12-293
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.3e-62
Family Integrin alpha N-terminal domain 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|186686591|ref|YP_001869787.1|
Domain Number - Region: 352-427
Classification Level Classification E-value
Superfamily Cadherin-like 0.000451
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 658-753
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0419
Family Integrin alpha N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686591|ref|YP_001869787.1|
Sequence length 780
Comment FG-GAP repeat-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MSVSFVNATNFLAGTNPNSVTTADIDGDGKKDLVIANSDDNNVSVLLNDGSGGFGAPTNY
TVGMSPSFVAVADFDGNSKLDFVVTNSIDNNVSVLLNNGSGGFGTPTNFAVGTNPNAVVV
EDFDGDGKLDLVVANSDDNNISVLLNDGSGGFGTLTNFAVGTNPNAVAVADFDGDGKLDL
VVANSDDNNVSVLLNDGSGGFGTPTNFAVGTNPRSVAVADFDGDGKLDLVVANSDDNNVS
LLLNDGSGGFGAPTSFAVGTNPRSVAVADFDGDGKLDLVVANSDDNNVSLLLNDGSGGFG
ASTSFAVGTSPRSVAVEDFDGDGKLDLVVANSTDNNVSLLLNNSNFDPTDLMLSATSDDD
DKTIIGLFTTTDPDQDDEHTYSLVAGTGDTDNNAFIIEGDSLKIKSDATKSSYKIRVRTT
DLGGLSFEKELDVNIDSFGSTTNTQITTIFQLVNITQNIFIVNSKVKGKKGKLSLKIKNN
NAKEVNELCVFAVDDEEGRIKGIAPGAEGYTRVALERSKVIFSSIAKLPKGFKNEDLKNI
LEFESGTKLRFYLVSNSTTEAVLSGKTSFSSVVFSSATNNNTEEEGFSLNFQDLVVTVQA
TEQEVSLGTGLQGKKQGELIDLRNVTQLVTAEFAVNREASYNNFVGFYQVADENGGIDTN
GDGKADILVGQAGYAEAAVRKRVAGIDLAVDNQGTANYAGTFGPNSLFAPFIIVDGKPDA
ILNGNGNKKVYFSFLGANSDKVDHIRLLGNNTFGFEDLPNGGDKDYNDMIVQVKLSISAA
Download sequence
Identical sequences B2J0F4
63737.Npun_R6586 gi|186686591|ref|YP_001869787.1| WP_012412780.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]