SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686622|ref|YP_001869818.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186686622|ref|YP_001869818.1|
Domain Number - Region: 64-159,257-301
Classification Level Classification E-value
Superfamily ARM repeat 0.00282
Family PHAT domain 0.077
Further Details:      
 
Domain Number - Region: 368-402
Classification Level Classification E-value
Superfamily YfbU-like 0.0144
Family YfbU-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686622|ref|YP_001869818.1|
Sequence length 438
Comment hypothetical protein Npun_R6617 [Nostoc punctiforme PCC 73102]
Sequence
MNANSLSISQENPHSVTSSSRQINVQIAQEEVYSFFMEIVKKLSPDDVLREFKGLFIDGL
DSEESDYIPGIYSIFLDDNEQELYNTLKRCCYIIVNNWKTNRKDKYIQELVNLFVNENLQ
IKDNNDPVVKICKTWLENFVNSKDYQELKLFAAKYDESSKGHWANRYSSYLLIDQSVNKN
NPIEQQEAARKLSKQIKEKFKFELAMYIARSQSTVSSTARYKNPSVLGDQALRLIKAIVL
KRGVFSHENIAHIFIKQTQNQTLEEFKINLEKYLFLSVGKESVEIWKQQFMEILSSWKKD
YNQEVITKELFLRTCNRVIDCLTIENNKEPSPLFMLLISQGHALTLVIILLKIILICNNS
RRHLETRIAHLIRFYENYPEDECKGVINFMEIFNITFAIYAENVEYNLIKMEEEQSSNPQ
LNLDGYRVFSQMKVDKPK
Download sequence
Identical sequences B2J0I5
WP_012412808.1.44837 gi|186686622|ref|YP_001869818.1| 63737.Npun_R6617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]