SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686673|ref|YP_001869867.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686673|ref|YP_001869867.1|
Domain Number 1 Region: 6-279
Classification Level Classification E-value
Superfamily Origin of replication-binding domain, RBD-like 1.51e-83
Family Relaxase domain 0.0000022
Further Details:      
 
Domain Number 2 Region: 394-824
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-24
Family Tandem AAA-ATPase domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686673|ref|YP_001869867.1|
Sequence length 1472
Comment mobilization protein TraI-like protein [Nostoc punctiforme PCC 73102]
Sequence
MLTGKNSEPQQAVHYFMEGYYQEGTSRWSGKGAKKLGLAGAVDCQETFSNIVNGRSPDGS
QNLCARKLDSSQRRAATDFTFSAPKSVSLQALVNGDERLITAHQLAVQKTLELIEERYSY
TRATTQNGQQLIRTNNLVVAEFDHIETRELDPHLHTHALVMNMTQLDNGKWYSLLNDEIF
KNKKFLGMVYQNYLAVEVQKLGYEVEARNHGQFEIKGFREEDLKEFSKRRQQILNSAGEN
ATWTEREAAWTATRNLKQKINPIELKAKWREEAAALGIKFVQPLEAQPELKPRLVSYENL
EDAIAHCSERNVAFTQEDLEKFILNQGLATEVSQIEPLVKANPELLSLSQENRDFTTLAA
VNRELATIKLMQSGTGKVSPLAHPEVVESHLEKTALNPDQRRAVLTAATTTDQFMAWQGV
AGAGKTFALKELKAIAAASGYTIKGFAPSSMAAKVLGQELDIQAETVARLLVSEPPQEIE
PNQIWIVDEAGLLSAKDALALLESATQEQARVLLVGDTKQLSAVEAGNPFKSLQQAGIKT
SHLNESLRQRAPKLKLAVDLIASGRIEEGFSRLDENGCIQSVRAESKIEAIACDYVTATP
EQRARTLVLAGTNFERLAITQAIRGHLKAEGSLGTATTITQLQAKDLTSVQMRYTHNFEL
GDMVMPTRNYKRRGLSKGKLYEVVDKDSDQLTLKASDGKHFQVDTGFKKAVYQRQQIELA
EGDRLRWTKNDRQLGRRNGQEFVVKAIAGYNAQIQYLESGQTEFINLQQAQHLDYAIVST
TYSSQGKTADQVLIAADNTIGQESFYVAVSRARYELKLYTEDKDNLLALAQSSRAKENAL
VLLRQKELEKQHQSKLEKEMVVTAPIVAKTPTKEAEEQRSGGAEEQSNSKLSPLHPYTPA
PVTSSSPLPLVFKTLPPEALKTVVPTPKPFIRKPVPKTAQSEVAFWTPGNIGEAPEKLDS
KHWQELIQGSGIHPEIASLNFTSLHQTLDWEHEAWEYLMYSDKLPRTNTGRLSSGIMSKY
AHIESGGWWCDAGVNPKCFANLQSGDKPDRKIWGCYKPNNPREKADKPGKFIKYEHPPQT
ELSIFLLDVPDDIAGRIYEKAGVKPTDCDRQSGFWYCIWKHNLPVTITEGAKKAASLLSQ
GHAAIGLPGIYAGYRSKDEFGEQTKARLMDELAVFATPERQITFCFDYETRLDTQRNIEI
AISRTGRLLEESGASVSVVTLPGPDKGVDDLIVAQGPLAYEKAFYEASTLKAWRDNNNKQ
RHSPPAPPKKLSDIERKQRLQQRFSGQISQLAFKKAINALTDRELLYLEQAVKEYFAQPV
AQVPAPVDKQAIENEITQLRPQIDSLWLEHAIQEKTIRAMEHFPLHKLSNKYNFTLKQQL
QTIGTIKELVTYQQQLQSKLQEYEAQVENHHSWKNQQQTIEMKTMAEILNSPQLQSRLTS
ILDEIELKQQQSQAKLSISQQPSPQPRRGLRR
Download sequence
Identical sequences B2JBQ2
gi|186686673|ref|YP_001869867.1| WP_012412855.1.44837 gi|186686673|ref|YP_001869867.1|NC_010630 63737.Npun_CF012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]