SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686708|ref|YP_001869902.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686708|ref|YP_001869902.1|
Domain Number 1 Region: 27-330
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.6e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0065
Further Details:      
 
Domain Number 2 Region: 1174-1220,1278-1307
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000157
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 3 Region: 1329-1432
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000157
Family Filamentous hemagglutinin FhaB, secretion domain 0.04
Further Details:      
 
Domain Number 4 Region: 1012-1202
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000232
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Domain Number 5 Region: 1505-1583
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000722
Family Filamentous hemagglutinin FhaB, secretion domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186686708|ref|YP_001869902.1|
Sequence length 1851
Comment filamentous haemagglutinin outer membrane protein [Nostoc punctiforme PCC 73102]
Sequence
MPIRTARLDWLQGLEIAIGSAVIALYANSSVAQITPDGTLPNNSNVRLEGNTINIQGGTT
RGANLFHSFEEFSVPNGSTAFFNNPLDIQNILTRVTGNSISNIDGLIRANGTANLFLLNP
NGIVFGQNARLDIGGSFSATTAKSFKFPDGSEFSATNPQAPPLLTINITPGLQYGASQAG
ATITNSGNLAPQQDLTLVADKLDLQGQLQAGRNITLIGNQEINLKTDLTLNPINDEFIGK
VSLTTTTGDVTTEAITINGGAIEIKSGGAIVTQTLDTRNGANNGGAIALTANGSIKTDDL
LSYSYSESGSTANGGNISLESAKDITTGDLDSSSDSRFASAGQGGAIALTANGNIQTDDL
LSYSYSESGSTANGGNISLESAKDITTGDLDSSSDSRFASAGQGGAIALTANGNIQTDDL
LSYSYSESGNAGNGGAIILQSSEASIYTDNINSSSFSSSGNAGNGGAITLQSSEGIYIYN
INSSSFSSSGNGGNGGAISLKAADDINIEDDLSSSSLNNVGNAANGGIVTISTTNGKIEA
QNLSSDSLSEFGNARNGGAITLESTNGINISGNLNSNSQANFGSAGQGGAITLSTSKNNV
STSSLYSFSSGEIAGDGGAIDIIAFNGNIAASNLDSNSLATDSVARNGGDISLITANGNI
KIGSISGGNLTFLADQIIADNGNFQSDDSVLIRSGSGGLATFISKYGSIISANSNVDVAA
NYVGASLLVEATGDIRFQGDINITRPDNITSFPIGADTETLSTRSALILRSGQSNLAYGG
VNSGSIPTYGTGNVPPGITIGGDVVLQPFNGIGGIVSLLAASGDVNTQLISSNGQQAPDS
NNTNGGAIALEATNGSISTGSMYSYSLYFNYDEDDGTAGNGGNISLKAANDINITGRFDS
SSDSNHTAGNGGAITLKAGNNINIADGLDSTSESSNYIAGNGGAITLEAGNSINITGVLD
SSSPISLDSSSGNGDLNLAGNAGNIDLKANNGITIAGSLFSTSGAGYTAGNGGNISLNTT
NGNISTSGLYSFSFGGDEQAGNGGNISLNTNNGNISTGDVESRSASFNGSVKNGGVITIK
AVNGSISAGPLSSFSFSNSKPEGNGGNISLFATNNIQLLSRGEFDSNTNQFKLVPGSSSI
NSTGGLGSGNITIISDAPLILDNTVISSDTFGSGKGGDIEITAPSISFKSGAQVSASTHS
NGQGGNITLVTSKFLELSGATTESPRSIFELGQDLGLAGIPPNTFLGGFIPTGNIEQEPA
AGTVFPSGVFTQATIDSTGNAGNLTIKTGQLIIKDGGAIATTTFGQGSNAGDISIKADSI
LVDNGSILSGVAGEARGDSGKINLQTRFLDVTNGGIVQTQTLGLGKAGEITVNATKQVNI
SGTGSALRSSSGGENSLLRNTNSAEIGQGGNINLTTANLRVVDNAVLDATTQTDSQGGNI
TVNANLFQTTTGGRLLTSTSGSGDAGDITVNVREMQLSANSGLFAQTLSSANAGNLTIQP
LNNEQNLLVNLEDGAQISASTLNSGKGGTLTVKAPESIAIRGNGSIISAETTGRGRGGDL
TLDTRKLTVRDGAQVTVSSVGSGEAGALTVNADSILLDNQGKIRADTTGGGGNIFLNSPF
LLLRRGSSITTNASGNDITGGNITIDAKNGFIIAVPSENSDIRADSENFRGGNVTIKNAA
GIFGIQSRKEPSPNTSDISAKGATPDLSGNVDITPPDIDPTNGLVQLPINLVDASNQISN
ACTPGTRQFQNTFVATGRSGLPINPTEPLQDSSTVSAWVRLRAKPENFANTTTQVQPTAV
SSSSQITAATPIVEASGWLVDSKGNLQLVAEVPQFNPHSLWQTPASCPVSR
Download sequence
Identical sequences B2JBT7
63737.Npun_CR053 gi|186686708|ref|YP_001869902.1| gi|186686708|ref|YP_001869902.1|NC_010630 WP_012412888.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]