SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686796|ref|YP_001869989.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686796|ref|YP_001869989.1|
Domain Number 1 Region: 18-369
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.44e-55
Family Filamentous hemagglutinin FhaB, secretion domain 0.0093
Further Details:      
 
Domain Number 2 Region: 392-493
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 3 Region: 466-617
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000847
Family Filamentous hemagglutinin FhaB, secretion domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686796|ref|YP_001869989.1|
Sequence length 751
Comment filamentous haemagglutinin outer membrane protein [Nostoc punctiforme PCC 73102]
Sequence
MTKALSWLIKGSTLFCLLPWEPIAAQIVPDATLRVNSSVTREGNNTSAITGGTQFGSNLF
HSFGQFSVPTGSTVYFKNALDIQNILTRVTGSSISNIDGLIRANGIANVFLINPNGIIFG
PNASLNIGGSFFGTTASNIKFADGISFDAKPLSGAEPLLTVSVPVGLGFGTNAGNIHVFG
DGQGIRKTSDLIDTSSGLRVQPNQTLALVGGDILLSRGTLKTTGGQIELGSVAGAGLVNL
IPTDKGWTLGYSGISAFGEIQLSGAAAVDASGDGGGNIQIQAMKLMLDGGSQIESSTLGA
GTGGTLKINASDSVNLVGLPEVDSFFNTGISSLVYPRATGSGGNINIETGRLNIRDGAGI
AAGTYGFGNAGSIEVLAHDSVEVLRKPTANAGSSITSLAQRGSTGSGGNIKIETARLSLR
SGGVISSGTFGQGSGGNVSITADEEVQVTGKSLTGNSPSRISARTGGTGKAGNLTIEAER
LTVTDGGRVNIGGEKIPKNLNFQPGQGNAGTLRINADSINLDRGTITAGTEGGTKGEGGD
IFLHSGDLQLRDSIITATAGGNGDGGNITINTDILVAIKNSSITANAFEGRGGNITINAR
GLFLSLNSLITASSKYGINGTVKYNIADTNIYPTQLKAEVIPITPEITPVCQARAGTEVN
SFRVSSTRNLQSKPNNLMFNNVEQSNSVPVPALNNSHNPKSLRSNQATQIIEANVLIRDS
QGNLVLTTDQANPTWDNASLSASSCFSGSQW
Download sequence
Identical sequences B2JAJ4
63737.Npun_AR065 WP_012412969.1.44837 gi|186686796|ref|YP_001869989.1| gi|186686796|ref|YP_001869989.1|NC_010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]