SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686902|ref|YP_001870095.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686902|ref|YP_001870095.1|
Domain Number 1 Region: 217-448
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.3e-65
Family DNA/RNA non-specific endonuclease 0.000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686902|ref|YP_001870095.1|
Sequence length 450
Comment DNA/RNA non-specific endonuclease [Nostoc punctiforme PCC 73102]
Sequence
MQTDYWTYEVKLDLVLFNFWRKVYRNGWLTGVVIVLLITFNTLFSAKGATTVEGFETGSK
GSYASSDVTLSTGLWNLDDALIGNLTSDAKSGTQSARIRNSGKVSMKFDRSTGAGTVSIK
HAKFGSDGSTNWQLWCSSNSGISWLQVGSTVTTSSTTLQTATFTPNISGTSRCEVRKSDG
TTNRTNIDDITITDYGTSGGGGSTSVHLTMGNPSGAGASDINNYLLDKAQYAVGYNCSLG
RANWVSWQLNSSWLGSTPRQDDFRADTTLPAGCYQVQSTDFSGSGFDRGHMTPSGDRTST
VTVNSSTFLMSNMIAQAPDNNQGIWANLEDYARTLVSQGKELYIISGGYGVGGTGSNGTF
STIAGGKVTVPNRTWKILVVLDTPGSGVSGVTTSTRVIAVNIPNAQGVRTADWRNYRVSV
DSLESLTGFDFLSLVSTSIQSVIEAQVDNL
Download sequence
Identical sequences B2JAV0
gi|186686902|ref|YP_001870095.1|NC_010631 63737.Npun_AR195 gi|186686902|ref|YP_001870095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]