SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686907|ref|YP_001870100.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686907|ref|YP_001870100.1|
Domain Number 1 Region: 816-1060
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-75
Family Sulfatase-modifying factor-like 0.00043
Further Details:      
 
Domain Number 2 Region: 65-131,385-429,662-785
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000448
Family PBS lyase HEAT-like repeat 0.012
Further Details:      
 
Domain Number 3 Region: 323-482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000132
Family Extended AAA-ATPase domain 0.071
Further Details:      
 
Weak hits

Sequence:  gi|186686907|ref|YP_001870100.1|
Domain Number - Region: 68-287
Classification Level Classification E-value
Superfamily ARM repeat 0.000219
Family HEAT repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686907|ref|YP_001870100.1|
Sequence length 1064
Comment hypothetical protein Npun_AF203 [Nostoc punctiforme PCC 73102]
Sequence
MVQDISQKFTLWLKVSLLGLSLPLLLSSSIRAEECTPADIKAQIEKFKDAKTFKAANDTV
VKCGEDAISSLAEALSNSDAATRTNAASALGKMGWIAQDAVPDIVETLGDGDENVRSSSV
RALIAIGRSAQQQANTISELDLKGITKLQLIKRQIEKALAHLDAKPKEWANQKLLQQELR
LTRNALQTKLNQLQDRIISRFIQWVIKNPGIFILLAVAAYLSIFSIRPLWLLSLNKVLPQ
TWKIPIINQEIAVKWLLFLNYKPRVLDTWVEKYIEPVKTEFLLKDIVKRDSGSHIPQPVE
FKDKIKYPQLKNNDNSTEEALEHKELQKELKAEMQREQQFCVLIEGEGGAGKTSLACQIA
NWGIEGKLANHRILPVLIDRDLQDNEDLLQMIRKQLQDLTNTGNDDITQEFLIHLLYQRR
VLVIIDHFSEMEKSTRNKILAAITENPIINALVFTSRVVGELKGLTRSTLKPMRVEGERI
SEFLGEYLKLCNYRNQFDDEAFYNACSRLNRMVGQRKITIMLAKLYADQMIATKYKAVDT
ELPENIPDLMLSYLNQLHPKAGSAQQLTVHQDLEIIAWKCLENTYSPTPISRITAEEALV
RPGSNEIDSRLDYLQTTLNILLKIEPDKVKINLDPLAEYLAGLYLVQQYKDNAEAWQKLL
NDIDEKSENLEKIKGFLLALWDCCEFKKNEFKIPDLVFQGLLKRANLDPKEIEAEQRKRR
IKILINELYTPEVEFRIRAVIDLQTMGKDANPAIPRLRKLLENNSEIAKVRREVAKTLKQ
LGQQNRMIILQIDNGVESIRLAEHPPTEEIYLGDKVILEMVRIQGGTFLMGAPETEEYSM
DSERPQHEVTVLPFFIGKYPVTQVQWLAVTSLPQVNRELDPDPSRFKGANLPIEKVSWYE
AVEFCDRLSQHTGKTYRLPSEAEWEYACRAGTTTSFHFGETITSELANYDTSEVSGVGVK
GRHQKETTPVGNFEVANAFGLYDMHGNVWEWCLDDWHDNYEGAPIDGSAWFNIYHKQAHF
VLRGGSWYNNPKFCRSAYRSNNNDRGNHGNITGFRIVCEIKRIL
Download sequence
Identical sequences B2JAV5
63737.Npun_AF203 gi|186686907|ref|YP_001870100.1| WP_012413076.1.44837 gi|186686907|ref|YP_001870100.1|NC_010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]