SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186687038|ref|YP_001870427.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186687038|ref|YP_001870427.1|
Domain Number - Region: 298-511
Classification Level Classification E-value
Superfamily ARM repeat 0.00504
Family PBS lyase HEAT-like repeat 0.046
Further Details:      
 
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0206
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186687038|ref|YP_001870427.1|
Sequence length 817
Comment relaxase/mobilization nuclease family protein [Nostoc punctiforme PCC 73102]
Sequence
MITKVKANKSFRGTTKYVLEKEKAKIIGGNMYGKSTNELVEQFTLSAHLNPQLKDPCYHL
MLSVPQTDRTLNDDVLANLSQRHLASVIVLSRLQGDESQVKQPEKRISDTKLKQLVDEFI
ETELPAYDFFIARHSDKEHDHTHIVASRVNNLDGKSIRTWNNYAYSEHSARLLEREFKLT
QVQSSWESKQKAMTRNQLERVEHDGLPGEEIMRRAIEQVAVNKPTMPQLIEHLWREHQVK
AIVSYYDHGGVRGIKFGIDVGSVNEDGSPRLLWKQGGNLNKYKCSFTKLQTELGISYDPK
RDDGEIKQLNNFLESVANNQVNQQLVTKILPVKTPTLAETISQLTPTQSDTEQQANSQLI
NSISDFIEQSVVESALIETLPQLTEQLSQYRQQSEAGRTAFDELLATIAEEEQLRSQRIV
DAIADFIEQSVVESTSSETLPELTEQLSQYHQQLANNKTTFDDLLVAITELEQRLSSQKA
VDAVADFIEQSVVESALVEALPQLKEQLFGYWQQLKASKIAFNDFETALTAELQSHAEKR
AILSISDYIDQSAIESALTQTVLGLTEQLSAYQQQLQAGITTFDGLETVIVYLEQLHSEQ
RTVDANALNKAQIPTTDKPKFKEEQRAELYKYYSTELQNLLVTDRDKEIAMRALKDDKPV
GEVEEILQASPAGWTQDEARELVLIASNQLATQKSEPEQSLDEKQRIESEFLAMAVPIAV
ELINWKLRETGSNSLRFKRATLEKQGRELVFTHDERGESFRVAVNRNSSGELEYSPINVG
SVETGDIIFWQEAERVLQQIRSSAEQQLRRQDKGISL
Download sequence
Identical sequences B2JC05
WP_012413390.1.44837 gi|186687038|ref|YP_001870427.1| gi|186687038|ref|YP_001870427.1|NC_010633 63737.Npun_DR041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]