SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186687105|ref|YP_001870248.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186687105|ref|YP_001870248.1|
Domain Number - Region: 160-228
Classification Level Classification E-value
Superfamily ARM repeat 0.0792
Family Armadillo repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186687105|ref|YP_001870248.1|
Sequence length 357
Comment hypothetical protein Npun_BR061 [Nostoc punctiforme PCC 73102]
Sequence
MVQAIDNTIATNFLTDAVVERHNFSQLNKTRIRFRIQLKKSTKSAAPKWADVLQAEVSEI
ESDLVKVTNSEVGLRGIKVFKKLDEAAAQLRQEIASVQEWMSADTGDWVCPIDLAPLVWN
QLINIRDNIAPGLRNQLKADYEAGLVDYQERIDQFLSLNTWELAQDKQESVKANLLRAFP
TLTDLEDYLQVVIGRPVIIPALSEQLNQQQAECLDQITKFIQQYDQNLEQRLRESALAGG
EQLAAQLLEELADWEPGRKPVQFKKKMERHLMKVQVLLANADSEAGSSLEAMMTHLDSIV
NDPAIESKNLGSDTRSQLQQKMQEIRIKLLDEQRNLQSLATEDVGLSKATVMSFKFR
Download sequence
Identical sequences B2JBA3
gi|186687105|ref|YP_001870248.1| WP_012413219.1.44837 gi|186687105|ref|YP_001870248.1|NC_010632 63737.Npun_BR061 372577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]