SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186687132|ref|YP_001870275.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186687132|ref|YP_001870275.1|
Domain Number 1 Region: 614-699,769-914
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.8e-29
Family GpdQ-like 0.026
Further Details:      
 
Weak hits

Sequence:  gi|186687132|ref|YP_001870275.1|
Domain Number - Region: 449-583,630-683
Classification Level Classification E-value
Superfamily ARM repeat 0.00195
Family PBS lyase HEAT-like repeat 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186687132|ref|YP_001870275.1|
Sequence length 1237
Comment metallophosphoesterase [Nostoc punctiforme PCC 73102]
Sequence
MIERVIGAFQNLGFDLTDTEIADILWLAVQMRSSQSSSVSETQQQNSASTQKTVSASPQL
PLEQNINFSKSINKTEANANVYPQSSQDNNETSSGLPIKVPTAQALRNKLEISRSLKPLK
RRVPSRNEFILDEIATAERIAEEKLLLPVMCPARDRWLEVALVIDEGTSMFLWQQTIKEF
KQLLERHGAFRDVRTWGLFTDKDSKVWLRPRTGNLSRQKRLHNPRELIDPNGRRLFIIIS
DCVSPAWYNGAVTKTLAAWANTSPTTIIQVLPEWLWERSTLGLAESILLRSLAPGVPNQQ
LIMTALDLLNESDVVNKLKIPVVTLEPESLKNWTRMVAGAGEVQTKGFLLALDGEILDVS
SESTENSNIELTAKQRLQRFRLTASPMARKLAGLLAAVPISLPIVRLIQQTMLQKSSQVH
VAEVLLAGILKPLSLVNDNVDTDKIQFDFIEGIRDLLLDAVPLTESTEVLRRLSEYLAQR
AGLSVDEFTAMLVNPALAVDSSSSSIFIRPFAQITAKVLRRLGGKYTELAKELEPSYQEL
SQDNISIQEIIKTLNDKDTDVRKIAASAIDKLPPELLPEKQQELRTTVEKRTEEEVNAFY
HDKEIYMNNADKQIRILHLSDIHLVTTAQAQRYFTQLATDLTQNLNVKQLNYLVISGDIA
NRSTQEEYDAAFELVDKLVKRYGLDPSRIVIVPGNHDLNWELSETAYTFVPKRKLPNPLP
QGKYIDAGSAGALICDESEYKKRFEYFSDRFYKKIYNKPYPQEYDQQAIIHFCPEDKILF
LGLNSCWEIDHEYRNRAGIHPNAISSALDQILTGNYDGWLKIAVWHHPVNGAESMKNTAF
LEQLAVNDFQVGIHGHIHEAKDENFQYDTRRGIKIIAAGTFGAPAKEQVTGIPLQYNLLT
LDPESGVMTVETRKKEKADGAWSADARWSDKNNPVPRYDIKLRYGTFKKEDQLIISNSNV
QFSQRTFFAIRHHSFELLTGLISKEDLPHNIRDYKIQHIEFDQSSFYIGGICDPSSAVKQ
NDKFINGFLKLFKANSEGKIGYYGIVHIPLQFCVGYAFSTWPKVFLFELDRNTNCWYQLA
SSDSPEIELNVIISRVKNPVAVAIRIAISFDILKSDVDDVLSQPYEDILIQIGKRRIDAI
SHYSQVNKICQAFRQVLDDLHNRLDKSLVVHIFYTGPVSLGFSLGRRISRTIHHQVIVYN
YTAHTQPRYAWGIKINGSNSPESRVVWTTPIISNAQE
Download sequence
Identical sequences B2JBD0
gi|186687132|ref|YP_001870275.1|NC_010632 63737.Npun_BR095 WP_012413243.1.44837 gi|186687132|ref|YP_001870275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]