SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186681966|ref|YP_001865162.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681966|ref|YP_001865162.1|
Domain Number 1 Region: 76-281
Classification Level Classification E-value
Superfamily ARM repeat 1.3e-33
Family PBS lyase HEAT-like repeat 0.041
Further Details:      
 
Domain Number 2 Region: 283-415
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000619
Family PBS lyase HEAT-like repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|186681966|ref|YP_001865162.1|
Domain Number - Region: 17-106
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186681966|ref|YP_001865162.1|
Sequence length 432
Comment HEAT repeat-containing PBS lyase [Nostoc punctiforme PCC 73102]
Sequence
MVSNINQLLVQAQTAYNAADWSSLIQYLQQLVLGSDSQHPEVVKNREYLLTLAISVLEMG
DFQQRWEITKVLTHLGNIAIPPLIDILEDEDAEEELRWYAARTLGEFQQPEAIAPLVELL
KTDEDEELKAIAATALGQMGTVAIAALSELLKQEDTRLLAVRSLSCIPQTETITPLLSVV
QDSQATIRTAAIEALSSFHDERIPTVLLNALNDIAATVRRAAALGLGFRPDLREALDLVT
RLQPKLYDFNLDVCCAAAVSLSRMGCNDAAKHLFDLLISPQTSTKLQLKTIRALSWVGTP
SSLEYLQTAFNQITSETLWQEIATVLGRVQKPQTTQAVEILLQILRLQHPATEIVNIKSA
IALSLGQLGEIQAIEPLISLLADSNASVRLHAIAALKNLDSEVAHQKLQQLANNTALTPD
LQQGIAIALAEW
Download sequence
Identical sequences B2J0K2
WP_012408237.1.44837 gi|186681966|ref|YP_001865162.1| 63737.Npun_F1530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]