SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186682935|ref|YP_001866131.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186682935|ref|YP_001866131.1|
Domain Number - Region: 8-47
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.051
Family Rho termination factor, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186682935|ref|YP_001866131.1|
Sequence length 294
Comment hypothetical protein Npun_R2634 [Nostoc punctiforme PCC 73102]
Sequence
MTQHLYTQQRLEGKTLQELKAIASQLGAAAQDKRLKQSWIEAILAKQPQPVVAPKPLVEM
DGDTCLVEGKAIATITNDEELTQPWVVKIEGVEVHRNATWARCYDYVRWHYKQGTLPSPQ
PEQVDDYLFHEDLPADNQPKVGDSHFIGNYLLRCIQVGGDYVAAWNVLDDGIPMGEIKMT
WQCFWEHNQSFTTFATPQEAVADLHESALLVCQKPLVSMSIMKFCASAALGIALVAQCMM
PIHAKEICNRGDGRRDVECTAVAEYTPQNNGGPDCGPCLGSGTRFKKQLMKQLS
Download sequence
Identical sequences B2ITF7
gi|186682935|ref|YP_001866131.1| 63737.Npun_R2634 WP_012409182.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]