SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683501|ref|YP_001866697.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683501|ref|YP_001866697.1|
Domain Number 1 Region: 167-327
Classification Level Classification E-value
Superfamily ARM repeat 2.43e-18
Family PBS lyase HEAT-like repeat 0.086
Further Details:      
 
Domain Number 2 Region: 370-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000188
Family Pectin methylesterase 0.034
Further Details:      
 
Weak hits

Sequence:  gi|186683501|ref|YP_001866697.1|
Domain Number - Region: 67-97
Classification Level Classification E-value
Superfamily TPR-like 0.000818
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186683501|ref|YP_001866697.1|
Sequence length 406
Comment hypothetical protein Npun_F3316 [Nostoc punctiforme PCC 73102]
Sequence
MIAAIRQKIRSAYADNPHLALCHWFHEFDNYVDSDNFAVCEGLLSEICKEAYPPLAAKEQ
AYVDSREGVLWLKKGIEHHKQSRFEEAQNYYQKSLKIQQRVQCRDAQTNVKVFQSVLAED
CLNGTPSYLKLDSFAQELHVLGGSESLLCDRLSTSTTPEERSQILFAAVQARLTKPLVQA
FRSPDEQTRMMGIAGLGRFKQINETQVLLEGLYDSNWFVRWRAAEALAHQIVICSACNSE
NPIGIKSCQACPADINLPEVTTDLFIQKLCAVLDRETSPDVRRVLVMLLGQTNNTGVTLT
LLAALDDSDADVRIAVIEALGKIGVPSGTIEKLRNVSDGKSLLGGSIKETLEKIIGTIAD
QSLRSETAIATYIVSQDGDGDYGTISKAIASVPPGSRILVQPGLYN
Download sequence
Identical sequences B2IZY3
WP_012409732.1.44837 63737.Npun_F3316 gi|186683501|ref|YP_001866697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]