SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685794|ref|YP_001868990.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685794|ref|YP_001868990.1|
Domain Number 1 Region: 840-978
Classification Level Classification E-value
Superfamily TPR-like 1.64e-25
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 359-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000173
Family Extended AAA-ATPase domain 0.053
Further Details:      
 
Domain Number 3 Region: 755-854
Classification Level Classification E-value
Superfamily TPR-like 0.000000000253
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|186685794|ref|YP_001868990.1|
Domain Number - Region: 583-736,857-917
Classification Level Classification E-value
Superfamily ARM repeat 0.000225
Family Armadillo repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685794|ref|YP_001868990.1|
Sequence length 979
Comment hypothetical protein Npun_R5747 [Nostoc punctiforme PCC 73102]
Sequence
MQTIRIQLRESTQETVELRYWLPQKNHYESRRLKLAEIANFLKQGERDYYKLLPNLPGIG
HQLFFWLDSDGRWLSRGIADCRGEGLVIAIDTDKKLAHLPWEVLHDGEDFLVKRVNPVVL
PLRWIEKETAGFLVEPRQLRVLFMATDPEDVEPKLEFEQEEARILADTRDFAVDLRVEES
GCVSELGKVWSRYFNDFDVFHLTGHASIKSEAPYTPYFITETEVGERHETTAAELAEVFR
FRFPKLVFLSGCRTGQAPDKGAVPSMAEALIEQGAIAVLSWGRPVEDRTATAAAAHLYGK
LAAGYQLAQALASTYQQLFKQKVRDWHLLRLYIQGECPGAFVEVWGDLPPSAPEPAYQQF
LDPDTQQVRVAKPYEFVGRRRTLQRCLKAIRTSLGVLIHGMGGVGKSTVTARLLERMVGY
HRLVNFRQLDEDKLLKTLAEQCTSERGHEILNGKLPLMQRLTKFFTEGLNTKEQRFVFVL
DDFEANLELRNGVYLLQPQVVDVLLALLKAMQNSQLPHKVIITCRYDFTLSELNHRLYRE
PLGALGGADLIKKCNRLDSFNGSWQFQPDLPERAKQAANGNPRLLEWLDKILQNSPKSAE
AERGVEMILQKMADKEKEFREDILAQELLKQQTPALRLMLGKLLVYELPVPQAAIKPICE
DISSWESHIQRAEILGLLEVTLTNNTERLYRVPRILSPLLEFPENPKGEELYKQAAQILY
RLWWEEETATESQKLEIHRLALLGKDEEIVGKIASSLANHLLHQSRFREAIHLCKSTLEI
TKNHSVLKEMAYSKHQMGEVDQALSYYQQALNFCPAEDERELASIYQHLCMLKDDKGDVD
EALALCNQSLEIFERIGNVQCKAEALGCLGNIYAGKGEVDEALALYNQSLEISERIGDVQ
SKAVTLSCLGNIYAGKGEVDEAIALFNQSLEINERIGNVQSKAATLIQLGNIYADKGEVD
EALALYNQSLEIFERIGNV
Download sequence
Identical sequences B2J931
63737.Npun_R5747 gi|186685794|ref|YP_001868990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]