SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685809|ref|YP_001869005.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685809|ref|YP_001869005.1|
Domain Number 1 Region: 233-398
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-41
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 13-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.31e-30
Family KaiB-like 0.00086
Further Details:      
 
Domain Number 3 Region: 154-239
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000706
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685809|ref|YP_001869005.1|
Sequence length 401
Comment adaptive-response sensory kinase [Nostoc punctiforme PCC 73102]
Sequence
MLKHDYMQVSQDQPIYSEAPLQLLLFVDGRPKSRQQVQRIRAYLKELQAEYTFEVQTIDV
GQQPYLAEHFKLVATPALIKIHPEPRQVLAGSNIIAQLKNWWPRWQVAVDAYLKLQEDLQ
EHMDDNGRGTLPKSTIHSVAVSAELIRLSDEIFRLKQEKDNLQEQLQFKDRVIAMLAHDL
RNPLTAAAIAIETLQSNYNLETGEFQRLKPSMTAHLLKQARNQTKVIDRMITDLLQVGRG
KDTEFPLSPQKVQLGKVFLDVLEELCDRYTAKSQEVETDIPSDLPYVYADPERIRQVLVN
LLDNAIKYTPEGGKISVSGLHRTTQKVQFSIGDTGPGIPVENRDRIFENHFRLQRDEGKE
GYGIGLCLCQRIIVAHYGQIWVDSAPNNGAWFHFTLPVYPS
Download sequence
Identical sequences B2J946
63737.Npun_R5764 gi|186685809|ref|YP_001869005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]