SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218778690|ref|YP_002430008.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218778690|ref|YP_002430008.1|
Domain Number 1 Region: 60-242
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.49e-20
Family RNA methyltransferase FtsJ 0.048
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000000368
Family Ribosomal protein S4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218778690|ref|YP_002430008.1|
Sequence length 245
Comment hemolysin A [Desulfatibacillum alkenivorans AK-01]
Sequence
MAKKQRLDTLITELGLAPSRTRAQALILSGQVLVDDVPQDKAGAMISPEANITVRGQDMP
YVSRGGLKLEGALEQLGLSVQGLDCIDVGASTGGFTDCLLQRGASRVIAVDVGYGQFAWK
LRQDARVVVMERTNIRHTVPEDLPWKPELAVIDVSFISLKIVIPVLLELMAQHCRIIPMV
KPQFEVGKGEVGKNGVVKDPAKHAKVLEDMEAFFKGLGLECIGPAPSPILGPKGNKEFFF
LLARA
Download sequence
Identical sequences B8FHX3
gi|218778690|ref|YP_002430008.1| 439235.Dalk_0835 WP_012609979.1.12191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]