SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218780434|ref|YP_002431752.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218780434|ref|YP_002431752.1|
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000889
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 227-283
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 342-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 398-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000392
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 511-563
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000458
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 566-619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 7 Region: 286-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 8 Region: 29-101
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0000000034
Family Lamin A/C globular tail domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218780434|ref|YP_002431752.1|
Sequence length 620
Comment thrombospondin, type 1 repeat-containing protein [Desulfatibacillum alkenivorans AK-01]
Sequence
MLRIMSAFSIAVLLALTAPALCRGGSPDDFVINEIHGDPAGDANGDGLINNGDRFVELVN
VSSEAVDVSGWTLSAAAGILHTFPANAVVPAGYPIVVFEGDVPTGLDDCAVFQTASSGAV
PIASGMDIVNLSDGSSTNSAFGVIGIDNGQSLNRNPDLDAQDVYYLHTNIEGANGKLFSP
GVRVNGFPFAADCICPVSCDMDGDGALGVSDALYIIQTAAGGRPDPGYYHWRAGEWSPCS
ETCGGGTYTRTVVCLDGNGDAAPDGFCPDPKPESASACNTHSCDYSWSAGEWSECSSLCG
GGTSTRAVVCLDGSGSVVADSFCTGSKPQTSQDCNEFACTYVWAIGPWSDCSVHCGGGTS
TRTVSCQDEGGNIVADGFCTGVKPAVSQACNGDPCSYSWHIGPWEDCSASCGGGAQTRNV
DCRDQDGNIVDDGYCAEIKPSSSQACNEDPCVYSWMVSAWGDCSAACGGGMQTRSVTCQD
QTGNIAADGLCTGAKPSETQACNTEACVYNWVVSAWGDCSADCGGGTQTRSVACQDQGGN
VVSDGNCADAKPSATQSCNTDACEYAWTVSSWSDCSVDCGGGLQIRSITCRDQFGNVVNP
ERCTDPQPAVSQACNAQSCE
Download sequence
Identical sequences B8FIP3
439235.Dalk_2591 gi|218780434|ref|YP_002431752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]