SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188527396|ref|YP_001910083.1| from Helicobacter pylori Shi470

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188527396|ref|YP_001910083.1|
Domain Number 1 Region: 305-449
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.8e-24
Family HD domain 0.02
Further Details:      
 
Domain Number 2 Region: 188-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188527396|ref|YP_001910083.1|
Sequence length 503
Comment phosphodiesterase [Helicobacter pylori Shi470]
Sequence
MKKIYYARGQTILKGASAKAKLMEFQAKSFVEAEEMRMKSQECKLQQQYENKNLQLQTHF
EKKEVHLKHLEAQHKEFVRDEKRYLEKEKQELEKERQILEQEKENFKKQCAVCKEAQAKA
LDAMLNYMAYTKDEIKNMVLEQLEEELEVQKSALIKRYEKEAKEEGKKRSYAILAEATAR
FAGNYAAENLTTRIALPCSDYIGRVIGKDGKNIEAFKKVSGVDIEFSEGSSELYLSSFNL
YRREVASETLKILIEDGRIQPNRIEEVYHRVARNMEKELLSEGESVVLELELGAMEDELK
ILIGKMRYRSSFGQNALQHSKEVALLAGLIAEQLEGDKKLARRAGILHDIGKALTQELGR
DHVNLGVEVCKRHKEDPVVINAIYAHHGHEEIMSVECASVCAADALSAGRPGARRKSDEE
YAKRMQALEEIALEFDGVEKAYAMESGRELRVIVKSNQVRDNQVPIIARKIAKKIEESAQ
YVGEVGVQVVRESRFKTTATLKQ
Download sequence
Identical sequences gi|188527396|ref|YP_001910083.1| 512562.HPSH_03025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]