SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188527559|ref|YP_001910246.1| from Helicobacter pylori Shi470

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188527559|ref|YP_001910246.1|
Domain Number 1 Region: 17-201
Classification Level Classification E-value
Superfamily HAD-like 0.000000000000922
Family HAD-related 0.035
Further Details:      
 
Weak hits

Sequence:  gi|188527559|ref|YP_001910246.1|
Domain Number - Region: 273-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0129
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188527559|ref|YP_001910246.1|
Sequence length 592
Comment hypothetical protein HPSH_03905 [Helicobacter pylori Shi470]
Sequence
MHKFLDGAKSEILKYDVISFDIFDTLLLRPFIKPTDLFLYIETKYDIKGFCQARILAEMQ
SREISKEQDITLDEIYHQIPKEFHSYKEVEIATEKEMLIPNLEMLELYRFAKENNKRVII
VSDMYLPLEVLEDILISKGFDGYTNFYLSSHIMLTKHSKDLFKHVLKQENITHTQMLHVG
DNSWADDAMPKSLGIATLFRKSVLKQFEEIFPKYQTFSLTSVAQSFILGSLCVFYKNYIQ
KHEKFDYWFLLGAMQAGIVAIAYCQFIYKEIHKRNIDTLVFVARDGYLLQKIFNILYPNS
YKTTYVYAPRILKKAVFLEVIEGESLEILRILEGEEEIKKKQITTNQQAYIYIYSNFEHC
RHLALKCLDNYRKYLSSLNLEGNIAIVDTITLGYSSQELIQKALNKEVFGCYVDLLRILN
HDCVSFLPFSHPKSIYFHNWDFMEFLLTSPEYPILNVENGVPIYQKNVSSCEKHRSKAYE
KIVEGAVGYASYFKESQISLDIHDVIKWVNFFIDHPSIQDQEQFKQIYFLPDATHKNALP
LFCNDVSLLSCILKPSQSYGILKRSLRTNKQERLFKILSLIKKIYEKLKKKS
Download sequence
Identical sequences WP_000548634.1.69492 512562.HPSH_03905 gi|188527559|ref|YP_001910246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]