SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193214309|ref|YP_001995508.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193214309|ref|YP_001995508.1|
Domain Number 1 Region: 112-390
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-70
Family RecA protein-like (ATPase-domain) 0.0000000374
Further Details:      
 
Domain Number 2 Region: 71-147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.77e-28
Family Cold shock DNA-binding domain-like 0.0000928
Further Details:      
 
Domain Number 3 Region: 18-61
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000271
Family Rho termination factor, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193214309|ref|YP_001995508.1|
Sequence length 437
Comment transcription termination factor Rho [Chloroherpeton thalassium ATCC 35110]
Sequence
MSNNSSNATEMDATTVGLNINVLQKKKVAELNQMAKEMGIATSGLRKDELIYKMIEAQTQ
KETTTETSNVVVNTGVLQTIPEGYGFLRSADYNYLSSPDDIYVSPSQIKRFNMRTGDTVS
GQVRAPKEGERFFALLKIETINGVDPEQIRDRVFFDNLTPLYPQERIKLETAPGQHPGRI
MDIFTPIGKGQRGLIVAQPKTGKTMLLQKIANSIIKNHPEVYLIVLLIDERPEEVTDMQR
SVKAEVVSSTFDEEPERHVQVADMVLDKAKRLVEVKKDVVILLDSITRLARAHNTVIPHS
GKILSGGIDANALTKPKRFFGAARNVEEGGSLTIIATALVDTGSRMDDVIFEEFKGTGNM
ELVLDRRLSDRRVFPAIDILKSGTRKEELLISQEELSRTWLLRKYLADKNPIECMEFILD
KMSETRSNKEFFKIMNA
Download sequence
Identical sequences B3QVA7
517418.Ctha_0590 gi|193214309|ref|YP_001995508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]