SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193213992|ref|YP_001995191.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193213992|ref|YP_001995191.1|
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0000000000000915
Family STM4215-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193213992|ref|YP_001995191.1|
Sequence length 172
Comment hypothetical protein Ctha_0273 [Chloroherpeton thalassium ATCC 35110]
Sequence
MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWTDADGLVIVRYAGSTY
GQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVITALAGFVPTDCTDALRV
VRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTDIQDLTIAST
Download sequence
Identical sequences B3QTJ8
517418.Ctha_0273 WP_012498828.1.43748 gi|193213992|ref|YP_001995191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]