SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193216117|ref|YP_001997316.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193216117|ref|YP_001997316.1|
Domain Number 1 Region: 486-657
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.02e-32
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 676-793
Classification Level Classification E-value
Superfamily CheY-like 2.7e-16
Family CheY-related 0.0068
Further Details:      
 
Domain Number 3 Region: 6-124
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000000125
Family CheY-related 0.0024
Further Details:      
 
Domain Number 4 Region: 297-404
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000803
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.077
Further Details:      
 
Domain Number 5 Region: 424-491
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000196
Family Homodimeric domain of signal transducing histidine kinase 0.013
Further Details:      
 
Domain Number 6 Region: 187-275
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000279
Family Flavin-binding PAS domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193216117|ref|YP_001997316.1|
Sequence length 797
Comment signal transduction histidine kinase, nitrogen specific, NtrB [Chloroherpeton thalassium ATCC 35110]
Sequence
MPKLVKILLLDHHAETEKALQQILAANGHQTISLIRVDSFSELKFQLGCFQPDLIISDYQ
IAGFTAIEVLDYLKHNKILIPFVIFTNPASEEIAASCIKAGASEYILKSNISSLPARISP
YINCASDFAEPICFHAQEHPLHAHAKDDMPTLSSLLPEDAYHHLCDLLTSQSQNIIFIFE
LSKEGAPEQFIYFNEATCQKLGYSYHELKNLFPIEIFSIGCCHTVQKHYESLTSQPSICF
FAELTTKEGLAIPTEVRGFTFMKQSRIYAISILQDARRQAAHDGVQQNLFLEKFSPIFHL
APIPIAILSRTELMFMDVNDNFIEQTGWEKDEILGKGVYDLHLLTRKQFKFSQALKILDK
QGYIKEIEISYRTKSGEIHYCLLSCKLFDLNGKECLLAMCHDISHLKHLEFEKQRKTARK
FQTQKMLSLCTLTEGIAHDFNNLMGIIMLAIDVIRTSTTDPEQLNRLKIIANATERGSAI
ARKLLIFSQSDDARFAPISLEYILKNLETLVRATSPKTIKIYFSYSAKHSAVFGDAEQLS
ELFSNLITNAIEAMPHGGTLRVELVQETNKELLELTLGENIPDHLIAVRVIDSGHGISEE
AQMRIFEPFFTTKESPKGSGGLGLAVVHGIVQNHQGYIDLQSSPSGTIFTIYFPLLPEAE
SQKKATEMLHYRKKSELTILIIDHNQADRNNLFNIIKGAGFNVIEVDSALSGLNTFKAHL
EEIDLVIAELHLPIMDGETLCKKILEINPLQKVILSYEPSPIAETRPRTLCNRTLDMIPK
PFQADDILNIISKSSID
Download sequence
Identical sequences B3QX59
gi|193216117|ref|YP_001997316.1| WP_012500951.1.43748 517418.Ctha_2420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]