SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190891976|ref|YP_001978518.1| from Rhizobium etli CIAT 652

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190891976|ref|YP_001978518.1|
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.27e-33
Family YdeN-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190891976|ref|YP_001978518.1|
Sequence length 185
Comment hypothetical protein RHECIAT_CH0002386 [Rhizobium etli CIAT 652]
Sequence
MKASDADILIIPGYTNSGPGHWQSRWEAKLSTARRVEQAEWTKPVREDWIARIAEEVNAS
TRPVVLVAHSLGVPSAIHAIPLFRNRVAGAFFVAPPDVTNPDIRPKHLMTFGPYPRDPLP
FPSITVASRNDPFGSYEHADDMASSWGSFLVDAGEAGHINADSGHGPWPEGTMVFAQFLS
RLSAD
Download sequence
Identical sequences A0A0M3GHB3 A0A192TCT9 A0A1W6GIE3 B3PP54 F2AD34
gi|190891976|ref|YP_001978518.1| 491916.RHECIAT_CH0002386 WP_004676258.1.10944 WP_004676258.1.12474 WP_004676258.1.19349 WP_004676258.1.22132 WP_004676258.1.22954 WP_004676258.1.25642 WP_004676258.1.26360 WP_004676258.1.35839 WP_004676258.1.76514 WP_004676258.1.79970 WP_004676258.1.81019 WP_004676258.1.82165 WP_004676258.1.84722 WP_004676258.1.88425 WP_004676258.1.9020 WP_004676258.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]