SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435851442|ref|YP_007313028.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435851442|ref|YP_007313028.1|
Domain Number 1 Region: 16-200
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 2.09e-45
Family NADH oxidase/flavin reductase 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435851442|ref|YP_007313028.1|
Sequence length 201
Comment nitroreductase [Methanomethylovorans hollandica DSM 15978]
Sequence
MTISTEIDVHQYRKPEINIDELFVRRWSPRAMSGQSVPDKDLMRLFEAARWAPSASNEQP
WRFIYAKKGTKYWDVFFDLVAEGNKRWCKNAAVLMVIISKIRFTKYDAENRTHSFSAGSA
FENLQLQATNLGLVVHPFAGFDENKAAEALGIPEEYYVDVMVAIGMPGKIGNLEEKDRIR
EFPSDRMKLNELIFEGKFDEK
Download sequence
Identical sequences L0KZH2
WP_015324664.1.68990 gi|435851442|ref|YP_007313028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]