SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435851658|ref|YP_007313244.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435851658|ref|YP_007313244.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000157
Family Cytochrome b5 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435851658|ref|YP_007313244.1|
Sequence length 78
Comment putative heme/steroid binding protein [Methanomethylovorans hollandica DSM 15978]
Sequence
MQEFTLEEVARYNGKNGEKAYVVYNDKVYDVTESGFWSEGEHMGLHESGNDLTNELEAEA
PHETSALDAYPVVGTIKK
Download sequence
Identical sequences L0L0C5
gi|435851658|ref|YP_007313244.1| WP_015324879.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]