SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435852460|ref|YP_007314046.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435852460|ref|YP_007314046.1|
Domain Number 1 Region: 55-243
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 6.65e-31
Family NADH oxidase/flavin reductase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435852460|ref|YP_007314046.1|
Sequence length 246
Comment nitroreductase [Methanomethylovorans hollandica DSM 15978]
Sequence
MQEIGKDFMKLTKFQYLGKAPQTNGYPQPPLQKESDDGIKIIELPDPDHIHVRDMPLRRA
IEHRTSVRSYSDKPLTLNELSYLLWCTQGVKEIIEDVVTFRTVPSAGARHSLETYLLINN
VEGLEPGLYRFLAIGHKLLQLDIETNMAKEITEACLGQDFVKKSAVTFIWTAVAARMKWR
YGERGYRYLHLDAGHVCQNLYLSAEAIDCGVCAIAAFLDDDMNELLDLDGEHEFVIYVAT
VGKNEG
Download sequence
Identical sequences L0KZH7
gi|435852460|ref|YP_007314046.1| WP_015325681.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]