SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435852529|ref|YP_007314115.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435852529|ref|YP_007314115.1|
Domain Number 1 Region: 443-553
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-17
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435852529|ref|YP_007314115.1|
Sequence length 562
Comment sulfate permease-like transporter, MFS superfamily [Methanomethylovorans hollandica DSM 15978]
Sequence
MPRVEQDNMDVKTGISGYFKESFLSDLKAGFITAIVALPLAIAFAIASGVEPVMGLYTAV
IAGMLVSATGGSKYSITGPTGAMTVIILSTLHSYGLEGLLLAGFLAGIFQILFGLFKLGK
VVKYIPLPVISGFTSGIGAIILIGQVPNALGMVIPAKEYAWETVVAIIENISAANTTALL
ICIATIVLLLYLPGILTKVKYLNSLPASIVALILSVLAIYYMKIDIPLVGSIPTGLPSIQ
MINLNPQLVLTVLPAALTIALLGTIEALLCAVVCDGMTNTKHDSNRELMGQGLGNIILPF
FSGIPCTAAIARSAVNIREGAKTQVSGIIHALILFTILLFFGPIAAFIPKAYLAGVLILV
SLRMINITEFKTIMHISKMDTTVLIATFILTVFTDLVFAVQMGMFLAIILLFIRLTNVID
IQTMENYDKSTGINATIFADPYLEKNVSVYTLNGPFFFGAMNVFESKINEHINISRPHII
LRMRYVPFIDSTGLERLRSFINMSKKKNQKVYLTSIQPEVMKRMKSDEHLMELMEKQHVL
TFEHTQEALEYVKKQSRSEKVA
Download sequence
Identical sequences L0L0V7
gi|435852529|ref|YP_007314115.1| WP_015325750.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]