SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189425593|ref|YP_001952770.1| from Geobacter lovleyi SZ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189425593|ref|YP_001952770.1|
Domain Number 1 Region: 27-83
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000109
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189425593|ref|YP_001952770.1|
Sequence length 166
Comment proteinase inhibitor I2 [Geobacter lovleyi SZ]
Sequence
MQTARLVCCLLSIMLAASGLSRSVAAAELPETCRLQPVNGRCKAMIEKFRFDQACGKCVA
YFYDGCGPVVPFDSLDACRQLCEAAQPALKKRASGLYYDPVEDDPRYAEVFRKIDAEVQE
ALTGHPQRGSMGFVHLVWETKKRILLQKYGIDWKTPAELNPQVMFD
Download sequence
Identical sequences B3E6A3
WP_012470582.1.41214 398767.Glov_2536 gi|189425593|ref|YP_001952770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]