SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49302 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49302
Domain Number 1 Region: 29-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-20
Family PDI-like 0.074
Further Details:      
 
Domain Number 2 Region: 303-403
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.59e-17
Family PDI-like 0.034
Further Details:      
 
Domain Number 3 Region: 418-517
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000137
Family PDI-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY49302
Sequence length 746
Comment pep:novel supercontig:GCA_000004155.2:supercont4.9:275644:278255:1 gene:SPOG_04348 transcript:EPY49302 description:"ER associated protein disulfide isomerase Pdi2"
Sequence
MQVFASLGLKTWIQWVALVAILFQVATASVPLTDENYQTEVKNGQWFIKFYSPTCPACKR
IAPMWDGMAKKIEEKANQVNIHIGEVNCKKYLNLCKDVKDFPTLRFYVNGENKDEVNYSG
TTTEASLLDFVDARIADAEKEVDAENAEAQKKVSEDATTSDPSFTTSTSSLSLGFVSGTS
TNPHTDFTDLKMVQVSPKTSSISPISSSLPSSSFTVAQSTGIPKENHSKASSTSPISTVS
APMSAEEKFTATSVSASSTTSQATYAIQTAPNVPDEGGDLSEPVNEDSEKAAQPNPTGHS
KPLVTQEDIDNALSSETGWFVHFYSSECTDSAVTTATTAWNAMAGRMKNKLNVGHLDCSK
HKPSCNKYNIQHYPSSIFFKENEYVEYNGLFKVGDLTSFAEEAANFKIREVEFFDTTESE
KHGDVFFLYFYDDKSADTLSAVRKTAIQLLGHARLYLTKSQQLVKKYNVNSLPKLIVVKD
STPSYYPTSVASDITDYRRILNWMKNNWLPVLPELQTFNSDEIANTDTVVLYFLDPDSSN
FQETKSTARKIASDWLNEESRNYQTAWKEETDKKNAHLNKAEEKNDAEALEAARNMNVKH
KPAPTRFAWVNGNYWAKWSNKFNLDINNTGPRVILYNPSKGIYWDTNAKGEAITVDEDVV
FEVLKDVEANPNALKPKKLKENAGLEYLASYGLDTRALYLICGVVCVGIIVSLFGARRIR
SLERRHRSSPILPIATKNTGNTGKFD
Download sequence
Identical sequences S9WX38
XP_013025878.1.62511 EPY49302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]