SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49454 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49454
Domain Number 1 Region: 93-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.4e-49
Family Glutathione peroxidase-like 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY49454
Sequence length 264
Comment pep:novel supercontig:GCA_000004155.2:supercont4.8:41420:42771:1 gene:SPOG_01341 transcript:EPY49454 description:"copper chaperone Sco1"
Sequence
MFRRRAIGPASQIASLLKANVRSTASPFRTCFDGRRMIAGKRTATQHAWRSMLSVRAAAV
AAVTSVGLYFYLQSEKQKALESKKEKALSTVGRPKLGGPFSLLNHRGERVTDEDFKGKFS
IIYFGFTRCPDICPDELDKLSAAIEIVNNVVGDFLNPLFITCDPARDPPSEIAQYLEDFH
PKIVGLTGTHDEIKDICKKFRVYFSTPKDVDPQKDDYLVDHSVFFYLMDPNGQFVEVFGR
NSTAEDMARAIGSYALSWKSNAKL
Download sequence
Identical sequences S9VTI4
XP_013025483.1.62511 EPY49454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]