SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY50126 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY50126
Domain Number 1 Region: 221-355
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.11e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 79-213
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.62e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 36-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000305
Family Glutathione S-transferase (GST), N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY50126
Sequence length 360
Comment pep:novel supercontig:GCA_000004155.2:supercont4.6:14043:15291:-1 gene:SPOG_00889 transcript:EPY50126 description:"glutathione S-transferase Gst1"
Sequence
MIITTDTTASVRRLTISSLNTSTWLQLDSCNPNHRGDIAHSEKRKKQHLSYNPNGRVPTL
IDHQNNDYAIWESDAILAYLTDRYNKERKISLPHDHPEYHHLLQYLFFQSSGQGVIWGQA
SWFNFYHPEPVASAITRYRNEIKRVLGVLESILQDKDYLVADKYTIADMSFINWNDLLPA
LFGKGRHEFKEDLPQLDFEKEFPKTYAWHKHRYNKERKISLPHDHPEYHHLLQYLFFQSS
GQGVIWGQASWFNFYHPEPVASAITRYRNEIKRVLGVLESILQDKDYLVADKYTIADMSF
INWNDLLPALFGKGRHEFKEDLPQLDFEKEFPKTYAWHKRLTERPAVAATIAERQQALQQ
Download sequence
Identical sequences S9X8H5
EPY50126 XP_013024614.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]