SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51247 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51247
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-66
Family Glutathione peroxidase-like 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY51247
Sequence length 192
Comment pep:novel supercontig:GCA_000004155.2:supercont4.4:474713:475570:-1 gene:SPOG_02423 transcript:EPY51247 description:"thioredoxin peroxidase Tpx1"
Sequence
MVLNIGQPAPDFKGTAVVNGAFEEISLSQYKGKWVFLGFYPLDFTFVCPTEIVAFSEAAA
KFAERGAEVILTSTDSEYSHLAFINTPRKEGGLGGIKIPLLSDASHKISRDYGVLIEDAG
VAFRGLFLIDPNGVLRQITINDLPVGRSVDESLRLLDAFQFVEEHGEVCPANWQKGADSI
DTKEPSKYFGKQ
Download sequence
Identical sequences S9X2B3
EPY51247 XP_013023818.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]