SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51344 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51344
Domain Number 1 Region: 54-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000441
Family Thioltransferase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY51344
Sequence length 236
Comment pep:novel supercontig:GCA_000004155.2:supercont4.4:696164:697475:1 gene:SPOG_02517 transcript:EPY51344 description:"thioredoxin family protein"
Sequence
MFFLKKLLGSCLFLGSLMQAVQSVSCHSDETVSIQALEASGVAWKELELTPSCALDSSLV
SNLTDKNWDESIKSDEWLVQLTLNPCDFCLKEDYIFNDLSHHMKETYPNIQFGRVYVNDN
PELAVRLLVEKLPIYYFINGANYYTVPASELPAKKALTAYSKHKFSEFERVKGFFSFVGP
FMIFYKFLGKILALYSRFSSPYTPLLINISMFVMAMLFINRSNKRRRQRKQIKKEK
Download sequence
Identical sequences S9VYR1
XP_013023913.1.62511 EPY51344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]