SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51496 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51496
Domain Number 1 Region: 6-366
Classification Level Classification E-value
Superfamily tRNA-guanine transglycosylase 2.75e-58
Family tRNA-guanine transglycosylase 0.00037
Further Details:      
 
Domain Number 2 Region: 434-609
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.93e-33
Family Phosducin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY51496
Sequence length 639
Comment pep:novel supercontig:GCA_000004155.2:supercont4.4:1028428:1031747:1 gene:SPOG_02668 transcript:EPY51496 description:"queuine tRNA-ribosyltransferase"
Sequence
MAAYPSSARISSVSLKNKVLQTPCFIFPTSKGTIPHLTPDNINHNEVPVVYFGLEDSLDL
LEKSPILNADGEIDKWVAGTPSQSILIAPRRSSPLPSVSAGPHHIQVLTSSGLRKLTNEV
YVKAITKLRPEIAIPLNDNPSNAPGVKRKPKMIERSVTWTDELLTVLQNKQLTEKVKVFF
PIPNVEAPFLNPLIERFRENDYQQNISGLACYGNLQSIPSELSIYPKLFLRPLLTPLAIL
QSIHQGADIVMADLVNQASDAGIVFTFSFPPPVEDLQNRKLELAWDMWHNRFATDLSSLQ
PGCNCNICQSYSRAYVHHLLQTRELVGWIMVQQHNIHVFHNFFCGIRDSIAAGSFLEDTE
RFERIYAPNFPRTTGLGPRKRGYQMDLTDVQPIENKPNWVQLKTETDDDKTSHMIQKKEN
AQEFQEPELPERDTTVGNFADTYAAQSENKSGSELEEDLLAELDEIDDSAYRENRMQSLK
EEFERVSAAKEKGHMQYLTVESEREVMDLTTSSKRVVIHFFHPDFRRCKIMDSHLEKISK
SHWETKFIRIEAANAPFLALKLGLKVLPVVLCYVDASLVSKLVGFADLGNNDDFDTPVLE
FWLLKWAAIEKIKENIPQGKKSIMGFKDTKNESEDSDLD
Download sequence
Identical sequences S9XCD0
EPY51496 XP_013024063.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]