SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51700 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51700
Domain Number 1 Region: 140-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.41e-33
Family PDI-like 0.0075
Further Details:      
 
Domain Number 2 Region: 35-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.07e-30
Family PDI-like 0.0067
Further Details:      
 
Domain Number 3 Region: 264-359
Classification Level Classification E-value
Superfamily ERP29 C domain-like 3.01e-17
Family ERP29 C domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY51700
Sequence length 364
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:275608:276855:-1 gene:SPOG_00125 transcript:EPY51700 description:"protein disulfide isomerase"
Sequence
MKVPLLVTLSFWLFALVAAKNVFEFTGLSQLENGIRSAKKGALIEFYAPWCGHCKNLLPV
YEELGQTFEEDDDILIGKIDADTYGEVGKKYQIRGFPTLIWYPADGSDPEQYSHARDLDS
LTQFVSEKTGVKKLKKNAFPSSVVELDSASFDKIVMDDTKDVLVEFYADWCGYCKRLAPT
YEKLASVFKNEPNVEIAKVNGDIYADIGMKHQVASFPTIKLFQKGRKDKPDAYNGDRSLE
SLTDYLNEKTGTQRSADGSLLPSAGRITILDDFASEFVDSSRAAKEVVFEKVKQFTMENR
TRWTQYYRNVFEKALKDESWVTKEAKRLSKILRRRSIALANADDFKARLNILRSFISSRN
DDEL
Download sequence
Identical sequences S9W0X4
XP_013023086.1.62511 EPY51700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]