SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51750 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51750
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.84e-107
Family Inorganic pyrophosphatase 0.00000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY51750
Sequence length 289
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:383338:384536:1 gene:SPOG_00175 transcript:EPY51750 description:"inorganic pyrophosphatase"
Sequence
MSEFSTRQVGALNTLDYQLFIEKNGSPVSAWHDVPLYANAEKTVLNMIVEIPRWSQAKLE
ITKEATLNPIKQDTKKGKLRYVRNCFPHHGYIWNYGAFPQTFEDPNVVHPETKAKGDSDP
LDVCEIGEARGYTGQIKQVKVLGVMALLDEGETDWKVIVIDVNDPLAPKLNDIEDVERHM
PGLIRATNEWFRIYKIPDGKPENSFAFSGECKNRKYAEEVVRECNESWERLITGKTDAKS
EFALVNTTVSGSVANDVSVANTIPAANELAPADVDPSVHKWFYISGSPL
Download sequence
Identical sequences S9W111
XP_013023136.1.62511 EPY51750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]