SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY52079 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY52079
Domain Number 1 Region: 174-253
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000134
Family PDI-like 0.016
Further Details:      
 
Domain Number 2 Region: 24-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000242
Family Thioltransferase 0.062
Further Details:      
 
Domain Number 3 Region: 304-370
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000737
Family PDI-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY52079
Sequence length 600
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:1085118:1087049:-1 gene:SPOG_00499 transcript:EPY52079 description:"protein disulfide isomerase"
Sequence
MIFSSLSYFFGFLVLAFALAESLVSNEDIYLGTHNASSILETRNIWFVTFTKSGEAFKEF
DDMWEATSSAYPNLHHAKVLCDLEFEFCKSQGVLEYPQIVVLRNGVWMRNVLDDSNHSVR
STLEFIEAHVTPCEMEFFKSGFKCLTEEKYEGEHLDSQEAVFELEEDESWKRVNTLRKPC
PDCFQWEPIWLSITRNVAEELTMGYVNCDAEEELCAYYEVNKFPTFIAFQQLDALKYEGP
LDYRELLHYANQLASYKTLHIQPQEIELVEGLYPTFFIFFHDYALTLEDEQSIKRMELYL
AGNAPLFQSDSTTLANRYGVHTFPAFVSVRNGEPFLYHANTPRQFRSHERVRNWIRQASI
PLVSELSPSNCHKMLGRQLSVIALLNPESETYLEDRASLLKLGKHWFQFQKRRERNFISH
QRVKKYTALTKAKRSKDSKKIKRIKYSVVEHPIFTESVSFLWTDSTVWQTWLLTNLGYSE
NLINKVTVFIIDNEREVFYTQGQDGRPLELDEPSLFSTLTAILDNAHTISHQNMGKATIC
GGKAYNRSVYFKPFIYCLILFLSCIMIILLIQKRRRSQPPRTQPILGFMDFHPLLTVKAD
Download sequence
Identical sequences S9W0X1
XP_013023462.1.62511 EPY52079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]