SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53021 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53021
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.49e-26
Family Thioltransferase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY53021
Sequence length 107
Comment pep:novel supercontig:GCA_000004155.2:supercont4.2:1769537:1770538:1 gene:SPOG_04749 transcript:EPY53021 description:"glutaredoxin Grx2"
Sequence
MSSIAKLFVEKAIASNPITVFSKSYCPYCSAAKKTLTDYTAPFKSYELDLLDSGSEVQAY
LMEKTSQGTVPSIFFKNEFIGGNSDLTRLRNNGKLSTMLAKLQQASD
Download sequence
Identical sequences S9XH72
EPY53021 XP_013022894.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]