SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53118 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53118
Domain Number 1 Region: 50-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.56e-30
Family Glutathione peroxidase-like 0.0000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY53118
Sequence length 198
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:177570:179331:-1 gene:SPOG_03659 transcript:EPY53118 description:"thioredoxin peroxidase"
Sequence
MSEYTASTPRRSSRLNSKDPSNVQGVAKPEKTETSSDTTASPANELEQSIDVGDLIPDLT
LLNQDEVPVKLSELVKSRGLVIFAYPRASTPGCTKQGCGFRDNYPQIQAADYEVFGVSFD
SCKSQKSFKTKQEFPYDLLSDPEGLLIERLGARKPDGKLFRSHWIFEKGSGKCLVKEIDI
SPLDSVDKVFQVVTGSNA
Download sequence
Identical sequences S9VZN1
XP_013021377.1.62511 EPY53118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]