SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53589 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53589
Domain Number 1 Region: 149-246
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.1e-29
Family Thioltransferase 0.00031
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.46e-26
Family Thioltransferase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY53589
Sequence length 247
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:1195108:1196297:-1 gene:SPOG_03177 transcript:EPY53589 description:"glutaredoxin Grx4"
Sequence
MSVEITSIDQFQEILQKDNEQVLLLNFYAPWAAPCQQMNQVFDQFAKDTQDAVFLKIEAE
KFSDIAESFDVTAVPLFVLIHGQKVLARISGANPQKLKSAIDEYIRPIIHQSSATPTSNG
PDANVGSVQTNAVSSGASGAKAANGLDVEMDNRLRTLTSAHDIMLFMKGTPSEPACGFSR
KLVGLLRERNVQYGFFNILADDSVRQGLKVFSDWPTFPQLYIKGEFVGGLDVVVEMMETG
EFQEMLT
Download sequence
Identical sequences S9W4Y3
XP_013021289.1.62511 EPY53589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]