SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53925 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53925
Domain Number 1 Region: 6-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-45
Family Phosducin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY53925
Sequence length 235
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:1946263:1947387:1 gene:SPOG_02853 transcript:EPY53925 description:"phosducin family protein"
Sequence
MDPNEDTEWNDILRSKGILPEKEPDVDDVLDDALVDAKELAHENRLEKKTLDELDELEDE
EDDEFLQIYRNKRVEEWKQKMSKAKFGSVYPISKPEYTQEVTEDSKNVFVVVHMFQDSIP
ACKLLNGILERLAPMYPQIKFVKISGKQAVENYPDIMMPTLLVYGHGDLQQQYLTLATLG
GMGTTVFDVAKALVHAGALREEDIAPLRESSSLNFESGRRHTDDADEEEDFDDFD
Download sequence
Identical sequences S9W855
XP_013020968.1.62511 EPY53925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]