SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49474 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49474
Domain Number 1 Region: 116-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-41
Family Hypothetical protein AT3g04780/F7O18 27 0.00017
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-29
Family Thioltransferase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY49474
Sequence length 279
Comment pep:novel supercontig:GCA_000004155.2:supercont4.8:82131:83954:-1 gene:SPOG_01360 transcript:EPY49474 description:"thioredoxin-like I protein Txl1"
Sequence
MSVIEIRSHQHWISTIPKSGFLAVDCYADWCGPCKAISPVFSQLASKYSGPQFVFAKVNV
DDQTQIASSLGVRAMPTFIFFENGKQIDMLPGANAQALKEKVANIAGKLNGGSAGGSTST
NGYGNLRSCIENPQLECLNQSDEHHLRNALDLDSSSYLESDADEQLMIYIPFLEAVKIHS
LSITPVKENLSKAPKTIKLFINLPTVLSFEDADSFPATQIIEDIEYKSDDEPINIPLRFV
KFQRVNSLVIFVSSNVGDEETTQIGRFELFGESVGDSSK
Download sequence
Identical sequences S9VTK3
XP_013025502.1.62511 EPY49474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]