SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49797 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49797
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.07e-33
Family spliceosomal protein U5-15Kd 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY49797
Sequence length 142
Comment pep:novel supercontig:GCA_000004155.2:supercont4.7:159283:160427:1 gene:SPOG_03271 transcript:EPY49797 description:"U4/U6 X U5 tri-snRNP complex subunit Dim1"
Sequence
MSYFLPHLHSGWHVDQAILSEQERLVIIRFGRDHDEECMKQDEVLYRIAEKVINMAVFYL
VDVDEVPDFNKMYELYDRTTIMFFYRNKHMMIDLGTGNNNKINWALEDKQEMIDIIETVF
RGARKGKGLVISPKDYSTRHRY
Download sequence
Identical sequences S9WYH5
EPY49797 XP_013025138.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]