SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49898 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49898
Domain Number 1 Region: 73-196
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.52e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.58e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY49898
Sequence length 207
Comment pep:novel supercontig:GCA_000004155.2:supercont4.7:389055:390501:-1 gene:SPOG_03368 transcript:EPY49898 description:"glutathione S-transferase domain-containing protein"
Sequence
MGEKMKLYGFEVSGHVHRVRLLLSFLKIPFEWIITQYADMNSEEIKQLNPWKQVPILKDG
DIVISDSNAIMVYLVKKYGNEDFWLLKDPLASSWVQRWFSYSAGELRYGPSTARRIQLYK
TNEDSEAPKQIAAKLFKFMNDYLEGKEYLVNDHITLADLAMYSYTSHAPEGHISLQPYPN
IVSWLKRIESLPEYVPLKWSYPSMKDY
Download sequence
Identical sequences S9VPN8
XP_013025236.1.62511 EPY49898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]