SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY49909 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY49909
Domain Number 1 Region: 80-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000748
Family Glutathione S-transferase (GST), N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY49909
Sequence length 220
Comment pep:novel supercontig:GCA_000004155.2:supercont4.7:412532:413729:-1 gene:SPOG_03378 transcript:EPY49909 description:"glutathione S-transferase"
Sequence
MSLGTLYSFKDNTRTVCLLELARRLNLQVDLVETYPHKFPAELAAKFPLQKLPVFIGSNG
LELSELVAILKYFYEVGKQNDTELLGAINAKEEAEIWQWIGYVNSDIVTPSVIRPWLGMC
RGATPYEEKPFKESSGKALGVLKKFNDMLIDRTFLVGNRFTIADLVVGSMLRLFYRFIVD
PEQRSKLPHLTRYYVTMFHQGNLSEIIPLELIPSVVIAKN
Download sequence
Identical sequences S9VUS5
XP_013025247.1.62511 EPY49909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]